Interesting article on an expert attempting to modify an article on Wikipedia. Sounds like an issue when presented in this fashion, but looking at it from Wikipedia’s perspective, I don’t
know how they could do better.
“One in three people in Switzerland download unauthorized music, movies and games from the Internet and since last year the government has been wondering what to do about it. … The overall
conclusion of the study is that the current copyright law, under which downloading copyrighted material for personal use is permitted, doesn’t have to change.” Wow, that sounds like almost
reasonable and understandable copyright law.
2011 Jun 20, 2:36A mix of 36 YouTube videos of various people playing Radiohead's Paranoid Android. It sounds good but the video too is very compelling. Also I would be psych'ed if it were my video picked to
rock out at 2:50.
Also, the movie Moon is really good on a variety of points. Sam Rockwell and the voice of Kevin Spacey! Its
available on Netflix Watch Instantly so you have no excuse!
2010 Sep 30, 2:48A surprisingly readable and delightfully accurate summary of the history of MIME in the web followed by proposed next steps. Sounds like a plan to me! "We need a realistic transition plan from the
unreliable web to the more reliable one. Part of this is to encourage senders (web servers) to mean what they say, and encourage recipients (browsers) to give preference to what the senders are
sending."mimecontenttypebrowserwebietfreferencehistorymimetypemime-sniffingsniffingtechnical
2010 Sep 27, 1:39Twitter account that retweets Kanye West's tweets with 'Liz Lemmon, ' prefixed to produce occasionally hilarious 30 Rock quote sound-a-likes.humor30-rockmemekanye-westmind-grapestwitter
2010 Feb 3, 6:52"Unwittingly, he trained a dolphin to kill the President of the United States." It sounds like a sentence constructed one word at a time by different people humormoviedolphinusposter
2010 Jan 26, 2:00The sandbox attribute for the iframe element sounds like a big pit of issues. Includes a new mime type text/html-sandbox to put on content that shouldn't be rendered as html in browsers that
don't support the sandbox attribute.htmlhtml5sandboxsecuritywebbrowseriframemimemimetypehtml-sandboxtechnical
2010 Jan 6, 3:41Public Domain Day sounds neat. Not just celebrating the public domain but celebrating new works now available in the public domain every Jan 1st. But we'll have to wait at least nine years to
celebrate in the US. We need to get the copyright lifetime to match up with retro things regaining popularity -- like when big band music was briefly popular again.copyrightippublic-domainlawlegal
2009 Dec 17, 6:13"In this remarkable and fully rockin' video, an Italian singer performs a rock piece whose lyrics are gibberish intended to sound like English"videolanguageenglishitalianrockmusic
2009 Nov 9, 11:39A montage of lines from movies containing the title of the movie. Worth it for the comments: "I'm just so tired of all these Star Wars." "That sounds really terrible. I will make sure write it
all down in my TYLER PERRY'S DIARY OF A MAD BLACK WOMAN."humorvideovia:waxymoviefilmquote
2009 Oct 8, 11:29The title sounds like its a line out of a text adventure. Actually its Stephen Fry and zoologist Mark Carwardine getting beaten by a parrot.videohumorparrotstephen-fryvia:dadecologybbc
2009 Sep 27, 2:28Poster demonstrating example differences between Arial and Helvetica. Love the end line: "my buddies [said] ... “a documentary about a font is as interesting as it sounds.” i could not agree more."visualizationfontdesignhelveticatypographyarialposter